GenomeNet

>mts:MTES_3444 K00886 polyphosphate glucokinase [EC:2.7.1.63] | (GenBank) glk; transcriptional regulator/sugar kinase (A)
MATNASRAVGVDIGGTGIKAGIVDLDAGELISDRVKVATPAGAEPADVLAAVKQVLETLE
APADLPLGVAFPAIVKGGRTMSAANVSKSWIGFEAEKFFEHGLSRDIHFANDADVAGIAE
VRYGAAKGIDGLVILTTLGTGIGSAMIYDGVLVPNSELGHLQRSGHKRDAEGYAAYSAME
REELSWEKWAKRLQWYYDYVEFLFSPDLIVVGGGVSKHSEEFLPLLKLRAPIVPAKHRNN
AGIIGAASLAVPLPEALPAVK

BLAST