GenomeNet

>mts:MTES_3444 glk; transcriptional regulator/sugar kinase; K00886 polyphosphate glucokinase [EC:2.7.1.63] (A)
MATNASRAVGVDIGGTGIKAGIVDLDAGELISDRVKVATPAGAEPADVLAAVKQVLETLE
APADLPLGVAFPAIVKGGRTMSAANVSKSWIGFEAEKFFEHGLSRDIHFANDADVAGIAE
VRYGAAKGIDGLVILTTLGTGIGSAMIYDGVLVPNSELGHLQRSGHKRDAEGYAAYSAME
REELSWEKWAKRLQWYYDYVEFLFSPDLIVVGGGVSKHSEEFLPLLKLRAPIVPAKHRNN
AGIIGAASLAVPLPEALPAVK

BLAST