GenomeNet

>mtu:Rv0904c K01962 acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2] K01963 acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2] | (RefSeq) accD3; acetyl-CoAcarboxylase carboxyl transferase subunit beta (A)
MSRITTDQLRHAVLDRGSFVSWDSEPLAVPVADSYARELAAARAATGADESVQTGEGRVF
GRRVAVVACEFDFLGGSIGVAAAERITAAVERATAERLPLLASPSSGGTRMQEGTVAFLQ
MVKIAAAIQLHNQARLPYLVYLRHPTTGGVFASWGSLGHLTVAEPGALIGFLGPRVYELL
YGDPFPSGVQTAENLRRHGIIDGVVALDRLRPMLDRALTVLIDAPEPLPAPQTPAPVPDV
PTWDSVVASRRPDRPGVRQLLRHGATDRVLLSGTDQGEAATTLLALARFGGQPTVVLGQQ
RAVGGGGSTVGPAALREARRGMALAAELCLPLVLVIDAAGPALSAAAEQGGLAGQIAHCL
AELVTLDTPTVSILLGQGSGGPALAMLPADRVLAALHGWLAPLPPEGASAIVFRDTAHAA
ELAAAQGIRSADLLKSGIVDTIVPEYPDAADEPIEFALRLSNAIAAEVHALRKIPAPERL
ATRLQRYRRIGLPRD

BLAST