GenomeNet

>mtu:Rv2194 K03889 ubiquinol-cytochrome c reductase cytochrome c subunit | (RefSeq) qcrC; ubiquinol-cytochrome C reductase cytochrome subunit C (A)
MTKLGFTRSGGSKSGRTRRRLRRRLSGGVLLLIALTIAGGLAAVLTPTPQVAVADESSSA
LLRTGKQLFDTSCVSCHGANLQGVPDHGPSLIGVGEAAVYFQVSTGRMPAMRGEAQAPRK
DPIFDEAQIDAIGAYVQANGGGPTVVRNPDGSIATQSLRGNDLGRGGDLFRLNCASCHNF
TGKGGALSSGKYAPDLAPANEQQILTAMLTGPQNMPKFSNRQLSFEAKKDIIAYVKVATE
ARQPGGYLLGGFGPAPEGMAMWIIGMVAAIGLALWIGARS

BLAST