GenomeNet

>mtu:Rv2243 K00645 [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39] | (RefSeq) fabD; malonyl CoA-acyl carrier protein transacylase (A)
MIALLAPGQGSQTEGMLSPWLQLPGAADQIAAWSKAADLDLARLGTTASTEEITDTAVAQ
PLIVAATLLAHQELARRCVLAGKDVIVAGHSVGEIAAYAIAGVIAADDAVALAATRGAEM
AKACATEPTGMSAVLGGDETEVLSRLEQLDLVPANRNAAGQIVAAGRLTALEKLAEDPPA
KARVRALGVAGAFHTEFMAPALDGFAAAAANIATADPTATLLSNRDGKPVTSAAAAMDTL
VSQLTQPVRWDLCTATLREHTVTAIVEFPPAGTLSGIAKRELRGVPARAVKSPADLDELA
NL

BLAST