GenomeNet

>mtu:Rv3145 K00330 NADH-quinone oxidoreductase subunit A [EC:1.6.5.3] | (RefSeq) nuoA; NADH-quinone oxidoreductase subunit A (A)
MNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGA
ASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVW
RRGGLTWD

BLAST