GenomeNet

>mva:Mvan_5542 conserved hypothetical protein (A)
MPSPATEIDVDGVKVRLTSPDKPYFPKLGKDGTKGKLFEYYLAVADRMVALLRDRPVHLQ
RFPDGIDGEEIYQKRVPQKHPDYLHTCTVTFPSGRTADALKITHPSAIAWAAQMGTVTLH
PWQVRCPDIEHPDELRIDLDPQPGTGFIEARSVAVDVLKPLLDELGLVGFPKTSGGRGVH
VFLRIATDWDFIAVRRAGIALAREIERRAPDAVTTSWWKEERGARLFVDYNQNARDRTFA
SAYSARKTPIATVSTPLTWEELRTAEPDDYTILTVPDFVAGRPDPWAGIDDTAQSIDTLL
EMVKADEERGLGDLPYPPSYPKMPGEPPRVQPSKKVAANWDEDGNRVGE

BLAST