GenomeNet

>mxa:MXAN_0864 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) glutathione S-transferase domain protein (A)
MIDLYTFATPNGQKVSIALEELGLQYKTHVVDITKGEQFKPEFLDINPNNKIPAIVDHAT
QDHRPLKVFESGAILIYLAEKTGQLLPSNQRGRAEVMEWLMFQMGGVGPMFGQLYHFARF
APKKVPYGIERYHAESRRLVGVLDGKLGSGDYVAGRYSIADIALYPWVAGARASFPELFR
GNSNVVQWLHRVGSRPAVERGMKVPQLK

BLAST