GenomeNet

>mxa:MXAN_0864 glutathione S-transferase domain-containing protein; K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MIDLYTFATPNGQKVSIALEELGLQYKTHVVDITKGEQFKPEFLDINPNNKIPAIVDHAT
QDHRPLKVFESGAILIYLAEKTGQLLPSNQRGRAEVMEWLMFQMGGVGPMFGQLYHFARF
APKKVPYGIERYHAESRRLVGVLDGKLGSGDYVAGRYSIADIALYPWVAGARASFPELFR
GNSNVVQWLHRVGSRPAVERGMKVPQLK

BLAST