GenomeNet

>mze:101465725 K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] | (RefSeq) coagulation factor XIII A chain (A)
MSDEATIAAPSPAPPAPTGPPPKVTNRGRTAAPAASANSETSDIPEYEYFIQPGPRGYPP
LTEYLDISEVDMMKRPDESNKIAHHTALYHSDYLIVRRGQEFQVKITFSRPYKPAEDKFA
LEFVIGSSPQFSKGTYVPVFPTKQRQTTWEGRITNTSDNVVTMAITPAANCIVGKYQMYV
AVVTPYGIRRTRKESTRDMYILFNPWVAEDAVFLDDETERQECVMTEMGIIYHGSYDDIA
ERDWNYGQFNYGILDSCLYIMDRAEMPITNRGDPIKIVRVASAMLNSRDDEGVLVGNWSG
DYTYGVAPTSWTGSTDILLTYNSSKMPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNYYSA
HDNDGNLKTDIIMDENGKIDRNRTRDSIWNYHCWNECYMSRPDLPPGFGGWQVVDATPQE
TSDGMYRCGPASVQAIKHGQICFPFDAAFVFAEINSDVVFHSRRKDGTLEPVRVNRTHVG
RLVLTKSPGDVTRRDITDQYKFAEGSTEERTVLEKAEEYGCKREKSSPPAADVDVVLPNL
EISVGDNFELNVEFENKSDERRTVDAYISGSVVYYTGVASTEFLFLTPRVVIEPKMNKKE
VAIVESKKYMKRLVEQANLHFIVTGKIRETGLIITAMKVVTLRNPKLIIEVSGRGKVSEE
MIATVEFTNPFSFNLENVYIRMEGPGMMEPKSRYYRLVIGGSSLTWTEYFTPQRAGTSRV
IATLDCPALRQVQGQASVTINP

BLAST