GenomeNet

>mze:101470970 K05625 transglutaminase 2 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase 2 (A)
MAQALDIDRWNLECEFNNTDHRTDLNGIDRLIVRRGQPFSISLYLRSGSYQPGVSSLDFV
AETGPQPSEQYGTRASFGLSASIDTSCWSAAVTSPPGDMVALSICSAPDAPIGRYTLTLG
HSARIEFILLFNPWCPGDAVYMDNKENLAEYVLAQDGIIFRGAYKHPIPTPWNFGQFESG
ILDVCLRILDMNPKYLKNPGKDCSGRRNPIYVSRVLSAMVNCNDDKGVLLGKWTGDYEGG
VSPMLWRGSVEILRNWDTQACQPVRYGQCWVFAAVACSVSRALGIPCRLVTNYLSAHDTN
SNLVIERYVNENGELLQSKEMIWNYHCWVENWMTRPDLKPDFNGWQAYDPTPQEKSEGVY
CCGPTPVRAIKEGELTFKYDAPFVFAEVNADVITFMKKKDGSTSKVSSNALVGQKISTKS
VGSDAREDITHLYKYPEGSAEEREAFKKADHQNKLLQQQQNQGLHLNIKVTSDMRKGCDF
DVFAVVTNNTQSEKKCRLLFGSCALSYNGFMGGNCGFKDLLNVELSPGGERKVPLRLNYS
KYGGQITEDNLIRLAALLLDYTTGDTTLAVRNVVLDNPEIKVRILGEPKENRKLAAEITL
QNPLPERLENCCFSIEGANLTGGGIITERLGPVGPGEDAKVKIYFTPTHSGLRKLVVDFD
SNKLCHVKGYRNVIIGK

BLAST