GenomeNet

>mze:101481227 K05625 transglutaminase 2 [EC:2.3.2.13] | (RefSeq) LOW QUALITY PROTEIN: protein-glutamine gamma-glutamyltransferase 2 (A)
MANHKGLISDVDLRSRENNSAHRTREIDQKRLIVRRGQPFSITVQCNGSLXPKHHLDLVL
HLGKRDEVEIKVQKVHGAGDKWWFNQQGAQDEMLLTLHSPADAIIGQYSLAVLLMSLDGR
VLEKKDKMSFHLLYNPWCKDDVVYLPDETQLQEYIMNEEGIIYMGTWEYIKSIHWNYGQF
EDYVMDICFEVLNNSNDALRDSQMDIEQRFDPVYVSRIITAMVNSNDDRGVLTGRWTEPY
SDGVAPYRWTGSAPILRQWSKAGVRAVKYGQCWVFAAVACTVLRCLGIPTRLITNFSSAH
DVDGNLSIDFLLDENLQPLESRGGRDSSWNFHCWVESWMRRDDXPKGNDGWQXLDPTPQE
LSDGTVLTVFCCGPCPVTAVREGNLGVKYDAPLXVAEVNADIIHWIVQRNGQRRKIRVDQ
TTVGRNISTKSVYGDFRDDVTVQYKYPEGSKKEREVYEKAGRRVTDVLSDSSEPGRLQLS
IKHAKPVFGTDFDVIIEVKNEGDQDAHVQLTMLATAVTYSSLYRGNCQKQTTTVMVPAHK
AQQEVLRLRYDDYAQCVSDDHLIRVKAFVEAPGENEPLLSVTDIPLSRPDVFIQVAGKAF
VREQVKASISFTNPLPVPLKGGVFTVEGAGLLSSTKIHVSGDISPGQTVSIVVSFSPMRT
GVRKLLVDFDSDRLKDVKGVTTVVVRKKYXNIFAEITEFY

BLAST