GenomeNet

>mze:101483349 protein-glutamine gamma-glutamyltransferase E-like; K05622 transglutaminase 5 [EC:2.3.2.13] (A)
MSSETRRSIFKGVGLNYEINNTEHHTKKLSKDQLIVRRGQPFTVKVELTQPFNPDLYPLT
ITAETGKHPSENLGTKSRFGIPDKISRSPSAKAVWKVELEKRSYPLTGSLNLTITPPADA
PIGKYNLTARYRNEETLLATLVVLFNPWCPDDSVSLSDEAQRQEYVLNEHGIIYSGSENY
IRSVPWDFGQFEEDMVKICLKILDVNPKHLANAANDVSARCNPIYVSRVVSAMINSNDDY
GVVEGRWSGPYSGGNEPTHWSGSYPILKHWYDINCQSVKYGQCWVFAGVMCSVMRLLGIP
CRVITNFQSAHDSNKNLTIDVYHADYGVREKKTKDSVWNFHVWLECWMTRTDLAKDGKYD
GWQVVDPTPQEKSDGVYCCGPAPVKAILDGETDLKYDVPFVFAEVNADCIDWLCKADGTM
TKMLSDTKSVGQNISTKTVGSNTRLDITDKYKYKEGTEKERTVFKYALSRNKETMGNEGA
TNSTNGTSPGGIVPQPKINIQFKEVSKPKDGQDVSLKLVLNSESSTARPVSINISVQAMR
YNGSPVENIQSEVKEETLLPGKDLSIPILVPFLVYHEHMVDSDSMKISAMVTDKLEPKNV
YLAVNDVILLDPPISITTPSLASVNQSTTAEVVFMNPVNKTLTDCTLTISGSGLVDGEQN
CILPDLKPSHRFRVTFFLLPKKTGKKTLLADFDCSSFRDLKCTCTVNVQP

BLAST