GenomeNet

>mzh:Mzhil_1092 DNA ligase D, 3'-phosphoesterase domain protein (A)
MSENLAEYKKKRDFNKTSEPSGNRTEEHKYPVFVIQKHNARNLHYDLRLEVDGVLKSWAV
PKGPSMDPSKKRLAIETEDHPIEYANFEGVIPEDEYGGGTVIVWDKGTYENINEKDDKLI
SMKDSIKKGHVKVILSGEKVQGKFALIKSSGRNKGQWLLLKMKGEDISTDHNGDILDIRP
ESVLSGKTIEDIEKI

BLAST