GenomeNet

>nal:B005_1107 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) phosphoenolpyruvate carboxylase family protein (A)
MLGTILAESGGEDLLADVEELRHKVIGAREGAVTTEEITALVGAWPLERAKQVARAFTVY
FHLANLAEEHQRMRALRERDDAANPPRESLAAAVRAIREEDGGEERLNELVAGMKFHPVL
TAHPTEARRRAVSTSILRISAQLDAWHAAHEGSAAAAEAHRRLLEEIDLLWRTSQLRYTK
LDPLDEVRTALSAFDETIFATLPKVYRTLDTAIDPEGSGTRPPRATPFVRYGSWIGGDRD
GNPFVTHEVTREAVTIQSEHVLRALENACGRVGRTLTVYANLTPASRALIDTLTEAEAAY
PTLMAEIGKRSPNEPHRRLLLLATARLSATRERDADLAYPGADAFLSDLRLVQDSLAAAG
AARQAYGELQHLIWQAETFGFHLAELEIRQHSEVHAAALAELESGGPLSDRTEEVLATLR
TVSWIQERFGVEACNRYIVSFTRSAEDIEAVHKLATYALPPKRVPVLDVIPLFETGADLE
ASPRVLAGMLELPQVRRRLDDNDRRLEVMLGYSDSAKDVGPVSATLRLYDAQARLSSWAR
EHDVRLTLFHGRGGSLGRGGGPASRALLAQAPGSVDGRFKVTEQGEVIFARYGQSAIARR
HIEQVGHAVLMASTDEVLERERAAAERFRPYADTIAGAAQETYLDLIGTEDFAVWFSRIS
PLEELGELRLGSRPSRRGAARGLGDLRAIPWVFAWTQTRVNLPGWFGLGTGLAAVADLPA
LQAAYREWPMFASLLDNAEMSLAKTDRTIAERYLALGGRPELTEKVLDEYDLTRRLVLRV
TGHERLLENRAVLSRAVDLRNPYVDALSHLQLRALEALRGEEADTLSEEDGRHLERLLLL
SVNGVAAGLQNTG

BLAST