GenomeNet

>nal:B005_2955 thymidine kinase family protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAELKYFTGSMNSGKSTMALQEHHSRGGEGVLYTKQDRAGSGIISSRLGLKSPAVEVGDA
LDLYDDVAERKAPYVICDEAQFLSYKQVGQLAGVVDGMGIDVYCYGILTDFQGQLFPGSK
RLVELADRIEVLPVYARCWCGNRATHNARVVDGVMVYEGEQVHIGGNESYTTLCRHHFMA
GVA

BLAST