GenomeNet

>nat:NJ7G_1715 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit (A)
MEVSVEGSDRMPRDTEVLVLGGGSTGCGIARDLAMRGLEVTLVERGNLTDGTTGRMHGLL
HSGGRYAVSDQASATECIEENEILREIAGHCVEETGGLFVQRPEDSDEYFQEKLEGCREC
GIPARVLSGTEAREVEPYLADDVARAIEVPDGAVDPFRLCVANAIDAETHGARVETHAEV
VDLLRDGDDIYGVEVRHESGPGKRTHATPGTTEEITADYVVNATGAWAGQIGAMADLEIE
VRPSKGVMTIMNVRQVDTVINRCRPKGDADIIVPHETTAILGTTDEEVPDPDDYPEEQWE
VDQMIDTLSELVPILEEARTIRSFWGVRPLYEPPGTGTQDPTDITRDFFLLDHADRDGVA
GMSSIVGGKFTTYRAMAEEIADHVCDKLGVTASCSTADEPLPGSENIETLEAGMDDFGLR
SPVARRSTQRLGSRASEVLETDDPNPVICQCEGVTRAEIRDAISQSGSDLNAVRIRTRAS
MGNCQGGFCCQNMANELHPTYDEETVREALDELFQERWKGERHALWGEQLSQAMLNYALH
ATTMNRDRDPASATGDIDFAAFDGGRPASDRVDGTRRAD

BLAST