GenomeNet

>nbr:O3I_019820 hypothetical protein (A)
MTESVDIEVDGRTVTISNPGKVYFTKRGETKLDLVRYYQAVAEPFLSVVGGRPLLLERYP
DGASGKSWFQKRVPKSAPDWLHTVEVSTPNGTTSDALVAHDLAHILWAVNQGCLGFHVWP
NRADNLKIADELRIDLDPSPGITFDDLKQAAVLTRDLCTELGIESRIKTSGSRGLHIYVA
LEPNWDGYQVRAAAVALARELERRHPDTITAQWWKEERGNRVFVDFNQNAPHKTVFGAWC
VRPKVGAQVSTPITWDALAEVVPDELTIATVPARLAEFGDPWAGRAPQSIAPLLAMSERD
MASGLLDAPWPPQYPKMPNEPPRVQPSRAKKEE

BLAST