GenomeNet

>nbr:O3I_020445 ATP-dependent DNA ligase; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MPAPMLAVSGRPPVDLGRWAIEMKWDGIRAVTVTRDRQCRFYSRNNRDISASFPELTAAF
TELLGDRELVLDGEIVAPEPSTGAPSFRRLQRRMHVLNPGAELLREVPVQYLIFDLLDDG
TALTSLPYTERRARLDELALDAKLIRTPPYYTDVDAGTMLGIAREHGLEGIVAKRLDSTY
QPGRRAPVWIKTPLRRTTEIVVAGWLPGSGRFTGIFGSIVMGAYDDADRLVHVGNVGTGW
TMRDRRALQARLNEITRPEPPFDVPPPRQVANAAHWVAPELVADIEFREVSSDGLRHPSW
RGLRPDRDPREAKVPSPD

BLAST