GenomeNet

>nca:Noca_1237 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP dependent DNA ligase (A)
MAQPEKEEVRVQVDGRTLTISNLYKVLYPRTGTTKGEVLNYYAQVAPTLLPHLAGRCVTR
IRWPHGVHEGSFFEKNAPAGTPSWVRTAEVPTTGSRAQSSSDTLVFPIIEDLATLTWLVN
LAALELHVHQWTVDRSGRPRGADRVVVDLDPGEPAGLHECCRVALMVRDRLAERGLAAKP
VTSGSKGLHLYADLPERVPSEDSSALAKAVAEELQGEHPALVTATMTKARRAGKVFLDWS
QNAGSKTTVSPYSLRGRELPTVATPLAWAEVEAGAQDPMALRQFRFDEVLERVQEHGDLF
AGPR

BLAST