GenomeNet

>nce:NCER_101278 hypothetical protein; K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] (A)
MKKVGIIGTGNWGTTLGFLVSKNVISNLKYFKKEILIYGIVEEFEGKSMDKLINEDHENK
KYLPGIKLPDNLCYTSDIQLFSDIDIIIVALPHQFIDSLIKFKEYLKKDIIVLSVVKGVI
EYKVSFTLVSDYINEIWGCSTNVLMGANIASDVAKGLLGNILYKCEGTLGYHQE

BLAST