GenomeNet

>nce:NCER_102427 hypothetical protein; K00850 6-phosphofructokinase 1 [EC:2.7.1.11] (A)
MKDFIEEFTLTIDTKSNELGKLYEELGLDVVYDTHSIKVCSSSLARIISINEGIHVHTLI
SGSEDKVIYDTLGNKVIVTFLRSKSLISVGIITSGGDAPGMNSAIRAIVRICLKSGGSVY
GVYRGFDGLINDYICKLGWDTETHNSNEGGTVLLSFRSKEFYKREGRKRAVFNLIKRGIN
SLIVLGGDGSLKGALILKNEWRELFRELLEEGKLDFLKDNNKVNDKYINDKE

BLAST