GenomeNet

>ncr:NCU06112 similar to glutamic acid decarboxylase isoform 67; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MNGFHSTDKPLNRASEVDHLIDAVKSLIIPYIRDADNAASFRATGQLPPDNRNVLVKSLR
PDQLVKELALSLPSGEGQGSQGLLETIQSILSYSVNTWDQGFMDKLYASTNAVGVVTELL
LSVLNTNLHVYQVSPALSVIEKYTAKQFAALFGFTGPRAGGVTCQGGSASNLTSIVIARN
TLFPLSKLHGNGHEQCGAPGPLILLTSAHGHYSIEKAAMTCGFGSSAVWTVPVDEQGRMQ
PAALREMVLKAKSEGKHPFYVNATAGTTVLGSYDPFDEIADVCDEFGMWLHIDGSWGGPA
VFSKKHKHKMQGSHRARSLTVNPHKMLNAPVTCSFLLTNDVKVFHRANTLPAGYLFHGPA
AAEEEEDADGEENAPQSQTTPSEEGVTTTNGCGNGNTQDEVWDLADLTLQCGRRGDALKL
ALSWIYYGAAGFERQIDGAFDMAAYLANLIAERNDFVLVSSNPPPCLQVCFYYAPGGKLA
DEPQENTRRTRIMVEKLIARGFMVDYAPGDKGSLFRVVVNCQTLRGTVEGLVKGLEAIGK
EIVPQ

BLAST