GenomeNet

>ncr:NCU09486 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MGDNFQLPSPAPAQAQEPQQNPTPQNATLLQAFEWYTPPDHAHFLRLSSQIPQLSQHGIS
SLWIPPSCRATSPQSNGYDIYDLYDLGEFDQKGSVATKWGTKAQLLELARKGKEYGVGLY
WDAVLNHRFGADHRERCKAVEVDANDRRVRVSGEYEIDAWVGFDFPGRGDQESTMKYHWY
HFSGVDFNADDPGKAGTIYQILGEQSQGWAKSPEDVDGEKGNYDYLMGCDVDYSHPEVVD
DVLNWGRWLAKEVSIKGIRFDAVKHFSESFLKKFVKMLDGEFGEGWFLVGEFWKDSLQSM
TDYLDRMDHKFSLFDAPLVYNFGEISTSVSADLRKVFDDTLVQKAPTLVQNHDTQPLQAL
HVPITPWFLPLGYALILIREAGYPCIFYGDLYGLCTPTSDNPSPTRPTSGPVTIIPKLLL
ARKLYAYGPQTDYFDYPTCIGWVRHGTWDKKDKCAVVMSNAGEGWKWMFVGVECAGQQWT
DVLEWRKEVVTIGENGWAEFRCGGCSVSVWVWEGAKGRDEFETQFDFDIYAASTAK

BLAST