GenomeNet

>ncs:NCAS_0A07630 NCAS0A07630; hypothetical protein; K01895 acetyl-CoA synthetase [EC:6.2.1.1] (A)
MCPTASSTTKPPSLVEELKAKAAAATTATTAAEQAKKEREYEHLTSVNVVKQAPITHRLQ
ADLASHYSPHVQDLQEYQKMYKQSLEDPATFFGGKAKQFLNWFKDFDQVYIPDPQTGLPS
FENNAWFLNGQLNACYNCVDRHALSNPNKVALIYEADEPGQGYKVTYKELLEQVSQLAQV
LKYSMGVQKGDTVAVYMPMIPQTIVTLLAITRIGAVHSVVFAGFSSNSLRDRINNADSKV
VITTDESSRGSKIIETKRIVDDALRETPNVKHVLVYKRTKNPKVHFEPNRDLDWTTEMMK
YKTYYPCEPVDSEHPLFLLYTSGSTGTPKGLQHSTAGYLLGCLLTMRYTFDTHQADVFFT
AGDVGWITGHSYVVYGPLLYGCTSVIFEGTPTYPNHSRYWDIIDEYNVTQFYVAPTALRL
LKRAGNSHLENNSLKSLRCLGSVGEPIAAEVWEWYSEQVGKNEIPVIDTYWQTESGSHLV
TPLAGGCTPMKPGSASFPFFGIETVILDPNTGEEIKDDHAEGVLAVKRAWPSFARTIWQN
HDRYLDTYLNPFKGYYFTGDGAARDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDN
TVAECAVVGFNDDLTGQAVAAFVVLKNKSCWANASEEELVEIKKHLVLTVRKDIGPFAAP
KLIILVDDLPKTRSGKIMRRILRKILAGEADQLGDVTTLSNPDIVRHLIDSVKL

BLAST