GenomeNet

>ncs:NCAS_0B02430 K01077 alkaline phosphatase [EC:3.1.3.1] | (RefSeq) NCAS0B02430; hypothetical protein (A)
MALKMSSNSYEHASLLQHPKRKQKRILPTTIVLIILTFIIYRLTSNNNEPFFEAKSKKKN
VIFFVSDGMGPASLSLTRSFRQYSQNLTIDDILTLDKHLIGTSRTRSSDSLITDSAAGAT
AFSCALKTYNSACGIDSNKNPCGTLLEAAHLDGLLTGMVVTTRITDATPAAFSSHVDYRF
QEDLIAEHQLGYYPLGRSVDLIIGGGRTHFYSTAPGGSRKDGRNLIEEAIDDGWQYVGNR
EQFDQLQMGKNVSLPLLALLADGDIPFDLDRDDTKYPSLEEQTLTALKALSEATEDSDKG
FFLLVEGSRIDHAGHQNDPSAQVREVLAFDKAFNSALEFINDLDTETIILSTSDHETGGL
VTARQVTKEYPDYVWYPSYLNNAKHSGEFLKSTVLSYNAEEHTMNEKEDFVRYEILENFL
GIHDYQEEDVKELATMTNPIDIQRKINYMISYRAQIGWTTEGHSAVDVYIYGYSNRKTSW
LQILENLQGNHENIEIGQFIKNYLKLDLDKVTKLVKDTDHSPKLSTKEVEELPLFDEYMH
QLKNN

BLAST