GenomeNet

>ncs:NCAS_0B06520 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) NCAS0B06520; hypothetical protein (A)
MLRAISRPLYRHGSKSLIKSALLKQYASKVTATRCLTTGSDTFLSTSNSSYIDEMYQAWQ
KDPSSVHVSWDAYFKNMSNPKVAASNAFQAPPILVASLPGAPSAHLSNSMDENVSLHLKV
QLLCRAYQVRGHLKAHIDPLGLSFGDSKDKPVPPELTLDYYGFTEKDLDREIILGPGILP
RFAKNGKTTMKLRDIIADMESLYCSSYGIQYTHIPSKVKCEWLRERIEIPKPYEYTIDQK
RQILDRLTWATSFETFLSTKFPNEKRFGLEGLEAVVPGIKTLIDRSVELGVEDVVLGMAH
RGRLNVLSNVVRKPNESIFSEFQGTTTTNNIEGSGDVKYHLGMNYQRPTTSGKYVNLSLV
ANPSHLEAQDPVVLGRTRALLHAKGDLKNQTKALGVLLHGDAAFAGQGVVYETMGFQTLP
EYSTGGTIHVITNNQIGFTTDPRFARSTPYPSDIAKAIDAPIFHCNANDIEAVTFIFNLA
AEWRNEFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYQKIAKQKSVIDEYTDKLIKEGSF
TKSDIDEHKKWVWGLFEKAFEKSKDYVPTQREWLTAAWEDFKSPKELATEILPHNPTNVS
VDIIQDIGKALSSWPENFEVHKNLKRILTNRGKSISTGEGIDWSTGEALAFGTLVLEGYN
VRVSGEDVERGTFSQRHAVLHDQKSEDTYVPLKHLSAKQADFSICNSSLSEYGVMGFEYG
YSLTSPDYLVMWEAQFGDFANTAQVITDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHS
SGRLERFLQMANEDPRYFPSEEKLQRQHQDCNYQVVYPTTPANLFHIIRRQQHRQFRKPL
ILFFSKQLLRHPLARSQLEEFTEGGFQWIIEDVEHGRAIGTKEETKRLVLLSGQVYTALH
KKRETIGDKSTALMKIEELHPFPFAQLRDAIDSYPNLEEFVWCQEEPLNMGGWAYAAPRL
QTTLQETQNYKNHTVRYCGRNPSGAVAAGSKSLHIAEEEAFLKDVFGQ

BLAST