GenomeNet

>ncs:NCAS_0B07030 NCAS0B07030; hypothetical protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MSGYHRRSYPRPPSSSHRPHGSAPNHQGPPYQEEREPSRSRYNNDGQGSFQETRYSGERE
SIGHRYQQPPSRVYKDQKHPDSGRVPYAARSIRRAIDEHANTRPQPFFPTRDSRYSQGNS
SPTAHVPLKIAKSVSSAGKPVRSLHSRPAPIIRYSEVTNLTAKYHYFDPVSKKLIHKDEM
STWNQKGKYPITGFVTILDSEQHPMIQARNPEIKSIDPRKLTSPTASISHRKLRNNLTNV
ARIVYDKYSVGPPPPCAIIVSPTSIINNTMIQDISIKNYFKKFGVISHFESFNDPNSALP
LHIYLIKYTAPNGKLSNLDIPVKSAYQAVKEFKEKGCFIMGSNFNVALNKEKLLEDIKTT
LVEENIKKAKQLSAVAISTEKKDRAPIAKNQKITMERPKRSIPYDLARAVNNKPCLFVSR
VFMALHGFRTEDFKYKLRRYRYSKFLDHITGLYIVFGDLLECKKCFELESGKMTLVSRSR
RIPIEIRFVLIPPVDQLPTRFGGFGKSTNLSPSTSSASHVKVYKTKDELINATVKYILKD
LKSILDTDIRKRLIGPTVFDTLNPTNFPELMSKKESKERAKQNAIETAAVEQKKLRESTN
QDFDIFNLYGGYTRKAIKKRRTSELSDISESISLKKKKLARPMAHLLNEDIGSKENTPTL
ESATPFDEFDNDHDLLSSTSSSEAEDGFIDDKQKVLTNESPVTTPETPQDDSLLFSSSKP
PKVDVTADLYKPSATEFPETVYKEDLSILKLSTPLSIVDLQNMVRDDEDLFLLKELVAYK
EPNTVNAADECLEYAIWKLREWKKNDTLIKENQLKLNEVPFAPALKIKNGPFKAENIRKV
PDRLKNCYLPHRRKLHQPLNTVNQHNTESVDKENSPEKLSKREDTVKPEPSESVVAQEIS
SSRDNRASNRRFQQNIEAQRAAIGTESELLSLNQLNKRKKPVTFARSAIHNWGLYALEPI
AAREMIIEYVGESIRQPVAEMRERRYLKSGIGSSYLFRVDENNVIDATKKGGIARFINHC
CDPSCTAKIIKVGGKRRIVIYALRDIAANEELTYDYKFERELDAEERLPCYCGSVNCKGF
LN

BLAST