GenomeNet

>ncs:NCAS_0B08930 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) NCAS0B08930; hypothetical protein (A)
MSFEDLHKATAQALTKAVDELVAEFEVTPAKLDELTAYFIEQMEKGLKPTADKATDLGLP
MIPSYVTGIPNGTEKGVLLAADLGGTNFRVCSVELNGDHTYNMEQMKAKIPDELLDDDTA
TSEQLFGFLARRTLAFMKKFHPEILEQGDAAKPVKLGFTFSYPVDQTSLNSGTLIRWTKG
FKIPDTVGKDVVELYQTALKKAGLPMVNVVALTNDTVGTLLSHGYTSDNTDSMTTGEISE
PIIGCIFGTGTNGCYMEEIEKITKLPEDLKKKLLAQGKTHMIINTEWGSFDNELKHLPAT
KYDIAIDKASANPGFHLFEKRVSGMYLGEVLRCVLVDLYKRGLIFSQYRSEKQLPHRLQT
EFELDSEVLSHIEIDDSTGLRETELSLLQSLRLPTSPSERIEIQKLVRAISRRSAYLAAV
PIAAIIIKTGVLNKRYHGEVEVGCDGSVIEYYPGFRSMLRHALAISPLGAEGERKVHLKL
AKDGSGTGAALCALVA

BLAST