GenomeNet

>ncs:NCAS_0C00660 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) NCAS0C00660; hypothetical protein (A)
MLYKHTNNQKNPRTLYPKKEEQEERIAAQTTQTRKSIVGLEDVKLLSSQLQEMSYPGATT
TLEQSQTTLANSYVIPRHGLPEDVAYNLVHNELNLDGNPHLNLASFVNTTTTDIANKLIN
ENINKNLADNDEYPQLIELTQRCISMLAQLWKCSPDLEPIGCATTGSSEAIMLGGLAMKK
KWEHRMQDAGKDISKPNIIMSSACQVALEKFARYFEVECRLVPVSKKSHYMLDPKSLWDY
VDENTIGCFVILGTTYTGHLENVEKVADVLTEIENQNPTWSNKDIPIHVDGASGGFIVPL
SFHTDHMKQYGLQRWGFNHPRVVSINTSSHKFGLTTPGLGWVLWKDDSYLSNELRFRLKY
LGGIEETFGLNFSRPGFQVVHQYFNFVSMGLNGYKALFKKSIFVSRVFAHSLLTSKKMPG
YFDIVSSTHERISDGGIPDYVSDYWDNTQDYKPGIPLVAFKLSDEFHENFPEIPQAMISS
MLRSRGWIIPNYPLPKSTDDSDQCEVLRVVFRSEMKLDLAQMLLIDIEGIITKLLYSYTK
VSKEAQHMQATPESRRSFIYEMLLALASPEEGDTETNPELKERTSRNYRGTC

BLAST