GenomeNet

>ncs:NCAS_0C00660 NCAS0C00660; hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MLYKHTNNQKNPRTLYPKKEEQEERIAAQTTQTRKSIVGLEDVKLLSSQLQEMSYPGATT
TLEQSQTTLANSYVIPRHGLPEDVAYNLVHNELNLDGNPHLNLASFVNTTTTDIANKLIN
ENINKNLADNDEYPQLIELTQRCISMLAQLWKCSPDLEPIGCATTGSSEAIMLGGLAMKK
KWEHRMQDAGKDISKPNIIMSSACQVALEKFARYFEVECRLVPVSKKSHYMLDPKSLWDY
VDENTIGCFVILGTTYTGHLENVEKVADVLTEIENQNPTWSNKDIPIHVDGASGGFIVPL
SFHTDHMKQYGLQRWGFNHPRVVSINTSSHKFGLTTPGLGWVLWKDDSYLSNELRFRLKY
LGGIEETFGLNFSRPGFQVVHQYFNFVSMGLNGYKALFKKSIFVSRVFAHSLLTSKKMPG
YFDIVSSTHERISDGGIPDYVSDYWDNTQDYKPGIPLVAFKLSDEFHENFPEIPQAMISS
MLRSRGWIIPNYPLPKSTDDSDQCEVLRVVFRSEMKLDLAQMLLIDIEGIITKLLYSYTK
VSKEAQHMQATPESRRSFIYEMLLALASPEEGDTETNPELKERTSRNYRGTC

BLAST