GenomeNet

>ncs:NCAS_0F01220 NCAS0F01220; hypothetical protein; K11427 histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43] (A)
MTTNTVPFTPSPSSSSIFSTSTTNFNNNNSRDSSMAPADSTEASLTEQTKKGKTRAKGSS
AVEKLLEEANRYHPQYEYSLPQGFLRTRKSKAASPSEEQASDLAKDDNLVKRKMEEEEDY
DTSTTAAKKVRKNKVTSTSSTKKRKRKIKKAETNGTTGSKPTKKRKDTIKRPLSPSAALA
DSVRRMSISAMLDDSDTKDGTGIYNEQGVKLDPVANKDDRAMTSTFLDWDQPYLELQYPL
FNVDSLKLTNVYKGNPIKSTILTSLTHHQSRHKPPSLSNDSSIKFVHLQSPLFVNYQEEY
MINFEKDLQRYNPMSEIGKLIEYTALVYLPSTYSEKLKREVIPSLNQAFDNSDTDRFISS
VERYNSIIRMVPRHEILEHLKTITQIPKSFIHDFLHIIYTRSIHPHASKLKHYKAFSNFV
YGELLPNFLSEVFSQCNLKPNCTFMDLGSGVGNCVIQASLEYGLKKSFGCEIMPDASELT
ELQMVELKERGKLFGFNLSDIEFSLRESFVDNPKVDELIKDCDLLLVNNFLFDSKLNEKV
EKITQNLKTGCKIVSLKNLRSFSYKIDFFNMENILSRLKVEKVLLKEDSVSWTHSGGEYY
IATVMENIDESLFDPVVRGRNTRRPTKYSR

BLAST