GenomeNet

>ncs:NCAS_0F04080 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) NCAS0F04080; hypothetical protein (A)
MVHLGPKKPPARKGSMADVPQELLNKLQELEQMFTVSAETSRAVVKHFISELDKGLSKQG
GNIPMIPGWVVEYPTGKESGDYLAIDLGGTNLRVVLIKLGGDRTFDTTQSKYKIPDGMRT
TQNPDELFEFIADSLAAFLEEIYPEGVTKNLPLGFTFSYPASQDKINEGILQRWTKGFDI
PGVEGHDVVQMLQKQLDKKKIPIDLVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDKVSDIPKLEGKLADDIPGSSVMAINCEYGSFDNEHSVLPRTKYDVQIDEESPRPGQQA
FEKMTSGYYLGELLRLAVLDLQSQGLILKGQDMTKLQVPYVMDTSYPARIEEDPFENLED
TDSLLQKEFNIKTTVQERKLIRRLCEVIGIRAAELAVCGIAAICQKRGYETGHIAADGSV
YKMYPGFPEKAAEGLRKIYGWKPAPMDQYPLQIVASEDGSGTGAAIIAALTEKRLAAGKS
VGIIGA

BLAST