GenomeNet

>ncs:NCAS_0F04080 NCAS0F04080; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MVHLGPKKPPARKGSMADVPQELLNKLQELEQMFTVSAETSRAVVKHFISELDKGLSKQG
GNIPMIPGWVVEYPTGKESGDYLAIDLGGTNLRVVLIKLGGDRTFDTTQSKYKIPDGMRT
TQNPDELFEFIADSLAAFLEEIYPEGVTKNLPLGFTFSYPASQDKINEGILQRWTKGFDI
PGVEGHDVVQMLQKQLDKKKIPIDLVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDKVSDIPKLEGKLADDIPGSSVMAINCEYGSFDNEHSVLPRTKYDVQIDEESPRPGQQA
FEKMTSGYYLGELLRLAVLDLQSQGLILKGQDMTKLQVPYVMDTSYPARIEEDPFENLED
TDSLLQKEFNIKTTVQERKLIRRLCEVIGIRAAELAVCGIAAICQKRGYETGHIAADGSV
YKMYPGFPEKAAEGLRKIYGWKPAPMDQYPLQIVASEDGSGTGAAIIAALTEKRLAAGKS
VGIIGA

BLAST