GenomeNet

>ncs:NCAS_0H00510 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (RefSeq) NCAS0H00510; hypothetical protein (A)
MRGGIKICRYARGVRSLHTVPKLTNVSRLSKEGIPRILSGKGFDIAWNQYQLSMVNRLNL
AVAGTALESMFPFHILLKTARDRHQAHIFNLASGLHNNHLFMENIIPGATTEGPSSLFLE
KVRESFDGKSWDVVKEEMLEQSLTGCLGQGWLFLVEREDKRLESMICHNNGTPYYFGRNQ
MLDLNSSVTLAEFTHWEDMKSVIRDSSKGKLKEKNVVKDWTIPLICINLGDVAYLNDYGI
LKRREYVKNCLDNLNWSVINNRLYSSTSSL

BLAST