GenomeNet

>ncs:NCAS_0I02880 NCAS0I02880; hypothetical protein; K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MTSQQVHVNDSIPKLFTNEEDKTDEVLATFTELKKCTYSSKKLGNSKNNDFIECDCYEDS
TNGVNHACDENSDCINRLTLIECVNDLCYSCGNDCQNQRFQKSQYADISIFKTKMKGYGV
RANADIETNEFIYEYTGEVIDEEIFRDRMIEYDEKKFKHFYFMMLQNCEFIDATLKGSLA
RFCNHSCNPNAYVNKWEVAGKLRMGIFASRKIIKGEEITFDYNVDRYGATAQKCYCEEPN
CIGFLGGKTQTDAASLLPQSYADALGIKVSMEKEWIKKMKEIGVKIKKHANDANNNVNID
FVESIDIQPCQTPDDVRKVMSVLLQVDNEYIALKLFHRLYSIEDEILLHQVIKLHGYICF
AKLLKTFADEINTEEEILELLERLPKTTKNGITSSQIDTQVSELSEEIPSLKEQCDMLLN
KWDKYETYRRITKKDISESSTNRMIDLRRIRLPLGWEIIYENGRPIYFNAQRQIKLNEPP
TEEHNVMNEKTNNNNNDDDDIKRHGGSVQSHDLLRNKRRREHLDNFVKKQKNGSKSDPWQ
RSGSKSNDLIDDPWRPRRGGSSNRSLDSSFQEEKKFSTPPQSSLEETVSKNNDELLRIIE
EANKQKEQEREEELQREREKEEKRLQRKSKSQVNVSEHKWNKFFASFVPNLVRKNVVGVK
LSHDHIKECSRDIVKILTSKELKKDDAKSPPEDLTREKKKKTNSFVKVYMEKFIEKYKSK
KHSHKH

BLAST