GenomeNet

>ncy:NOCYR_3242 ribulose bisphosphate carboxylase small chain (RuBisCO small subunit); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MYLRHGAFSYLPDLTDAEIGAQVRYALLNNWPVSIEYTDDPHPRNAYWEMWGLPLFDLDE
PDGVLAEINACRATFPRHYVRVLAYDASYGRQTTALSFLVQRPSDEPGFALRRVEGSDRR
QRYSLHSYATEARPGARYAD

BLAST