GenomeNet

>ncy:NOCYR_3243 cbbL; ribulose bisphosphate carboxylase large chain 2 (RuBisCO large subunit 2); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MAEETVRDRWDPGVQSYASMGYYAPDYQPSDTDVLAVFRVTPQPGVDPIEAAAAVAGESS
TATWTVVWTDRLTAHSKYQAKCYRIDEVPGRPGEYFAYVAYDLDLFEEGSITNLTSSVIG
NVFGFKPLLALRLEDMRIPVAYVKTFQGPPHGTVMEREYLNKYGRALLGATVKPKLGLSA
RNYGRVVYEACKGGLDFTKDDENINSQPFMRWRDRYLFAMEGVNRAMAETGEIKGHYLNV
TAATMEQMYERAEFAKELGSVVIMMDLTVGYTAMQSMSHWARRNGVLLHLHRAGHSTFTR
QKTHGVSFRVLAKWCRLIGVDHLHAGTVVGKLEGDPATTKGFYDTLRENVIATEPANGIF
FDQHWASLPGVMPVASGGIHAGQMHQLVELFGDDVILQFGGGTIGHPLGIAAGAEANRVA
LEAIVQARNEGRDLLREGPEVLRKAAAVNRPLDVALATWGEVSFDYTSTDAPDAVPTATH

BLAST