GenomeNet

>ncy:NOCYR_3243 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) cbbL; Ribulose bisphosphate carboxylase large chain 2 (RuBisCO large subunit 2) (A)
MAEETVRDRWDPGVQSYASMGYYAPDYQPSDTDVLAVFRVTPQPGVDPIEAAAAVAGESS
TATWTVVWTDRLTAHSKYQAKCYRIDEVPGRPGEYFAYVAYDLDLFEEGSITNLTSSVIG
NVFGFKPLLALRLEDMRIPVAYVKTFQGPPHGTVMEREYLNKYGRALLGATVKPKLGLSA
RNYGRVVYEACKGGLDFTKDDENINSQPFMRWRDRYLFAMEGVNRAMAETGEIKGHYLNV
TAATMEQMYERAEFAKELGSVVIMMDLTVGYTAMQSMSHWARRNGVLLHLHRAGHSTFTR
QKTHGVSFRVLAKWCRLIGVDHLHAGTVVGKLEGDPATTKGFYDTLRENVIATEPANGIF
FDQHWASLPGVMPVASGGIHAGQMHQLVELFGDDVILQFGGGTIGHPLGIAAGAEANRVA
LEAIVQARNEGRDLLREGPEVLRKAAAVNRPLDVALATWGEVSFDYTSTDAPDAVPTATH

BLAST