GenomeNet

>nda:Ndas_1484 ROK family protein (EC:2.7.1.63); K00886 polyphosphate glucokinase [EC:2.7.1.63] (A)
MSQLTTGLGIDIGGSGIKGAPVDLTTGEFLKERMKVLTPDRSDPEAVAEIVHGIAEHFPE
AAGMPLGVTFPGVVQGGVVRTAANLDKSWIDTDARSLFAEATGRPVRVLNDADAAAVAET
RYGAAKDVPGVVLMTTLGTGIGTALVVDGRLVPNTEFGHLEIDGHDAETRASSGAKEREA
LSYREWATERLQRYYRVVEDLLWPDLIVVGGGVSRKAEKFLPLLDIRTPVVAASLLNTAG
IVGAALAAAESETG

BLAST