GenomeNet

>nde:NIDE1881 rlp; Ribulose bisphosphate carboxylase-like protein (RuBisCO type IV-like protein); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MEYRLHGSAADARRRADLLCIDQTVEAADHVIPSGAIRDQLLGRVIQLEVITPDSHRAVL
SFPVELLDGTMSALLHMIIGMAGLQGQIRVTDLSLPDAVASRWTRPRYGSRGLRDLLRVP
RRPLICAVLKPLGYSPQQLADLAHEFALGEVDLIKDDQSLRDHPFCRFDERIARCAEAIA
KASRQTGKRCLYAPHISGPWPSLVEQAAKAMQAGARALLLCPGLIGFDAVASLAQLSSLS
LPLLAHPDFLGSHYVTPDSGIAPAMLFGLLPRLAGADVTIYPTYGLNYPISEEDCRQIAA
ACRRALGGCPPILPTAAGRMTASRIREMVTLYGSDIVFILGSDLRRGPTPIRSACLDFRR
LVEAETCSSP

BLAST