GenomeNet

>ndi:NDAI_0A00320 NDAI0A00320; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MSFDDLHKATAQALTGAVDELVAEFEVTPEKLDQLTAHFIEQMEKGLKPTEDKATDKGLP
MIPSFVTGTPNGTEKGILLAADLGGTNFRVCSVELHGDHTYTMEQMKSKIPEELLDDENA
TSEQLFGYLARRTLAFMKKFHPEQIEGGISAKPLRMGFTFSYPVDQTSLNSGTLIRWTKG
FKIADTIGRDVVQLYQDELKKNELPMINVVALTNDTVGTFLSHCYASDNTDSMTTGEISE
PVIGCIFGTGTNGCYMEEIKNIVKLPADVKKKLLDEGKTHMVVNTEWGSFDNELKVLPTT
KYDVDIDQKYSANPGFHLFEKRVSGMYLGEVLRNVLVDLHKRGLIFAQYRTEKQLPHRLQ
TPFELDSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPSERHEIQRLVRAISRRSAYLAA
VPIAAIILKTGTLNKRYHGEVEVGCDGSVIEYYPGFRSMLRHALALSPLGAEGERKIHIK
LSKDGSSAGAALCALVA

BLAST