GenomeNet

>ndi:NDAI_0A01940 NDAI0A01940; hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MLRQLGTTRILLPNLRPIRYITMPPATPSSSSSSSSSSARENNVSKGRKQQATLGRFFSS
INHKKPTKDTALKNESKEETKEENKDDSDSIPRKKIRLSTSSSSPSIMAESKPKSPIKLN
TERSSSPASASASTTPTPIVADHTLDPKTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSI
IKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLT
QIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLI
KRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVKEFDANKDFDMELLETA
EGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQ
GETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILD
CEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERR
EILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKR
SRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNDNTGEFETCCKIGT
GFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAG
SSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS

BLAST