GenomeNet

>ndi:NDAI_0B00260 K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] | (RefSeq) NDAI0B00260; hypothetical protein (A)
MSTDISIPPNKLFLNEEDKTEEALNSFIPIESCIYSSKKLGNSKNNDFIECDCYEDKDPQ
IHINHACDEDSDCINRLTLIECVNNLCYSCGNDCQNQRFQKKQYSNVSIFKTKLKGYGVR
ANENIENGQFIYEYIGEVIDEIQFRERMIDYDLKKFKHFYFMMLQNGQFIDATIKGSLAR
FCNHSCSPNAYVNKWEVAGKLRMGIFAKRKILKGEEITFDYNVDRYGATAQKCYCDEPNC
IGFLGGKTQTEAASLLPQSYAEALGIRPSIEKQWIKEMKRNGQKIEKAKNNDNNINVDFV
DSLDILPCETPDDVRKVMSILLQVDSTYMATKLFHRLFNITNENEILLHQVIKLHGYICF
SKLLDLFQDDSNTIEEILEFLMRLPKSTKNGIVSSQIDKKISNLSEEIPHLKDQCDLLIE
KWNQYETYNRIAKRDITNDLNGNGNGSSSNLSRLMDMRRVRLPLGWEIIFENGRRLFFNA
EREIKLTEPPTEEQLRLDDHAKDKDVNDNQNGRHRHQNRNRDNHHRPSRYNNNEDNLESH
WNHDKNKIDSNMMLSSKKRRRMERQLELSKARAYANKKRREELEKKIKGQTSSSTLNSPM
ENNSDNNNSSGKDDLNLNKSNSLNHSHNNAQTPSPTPADHPSGVETNKTEILKIIEHANK
IKELEREKELKLKRENEMKRKKKSISESNEHKWDNFFASFVPNLVRKNTGDVELSRDHIK
ECSRDIVKTLTSKELKRDDPKPPPEEATKEKKYKVNKFVKIYMEKFITKYKEKHSRAQSR
SRSDLHHHTGKKTSS

BLAST