GenomeNet

>ndi:NDAI_0B06350 NDAI0B06350; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MVHLGPKKPPTRKGSMADVPQELLNELKTCEDIFTVSDETSRAVVKHFISELNKGLSKEG
GNIPMIPGWVMEYPSGKESGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYKIPDGMRV
TKDREELFAFIADSLKAFIEEVFPDGVTGTLPLGFTFSYPASQDKINEGILQRWTKGFDI
PNVEGHDVVKLLEKHLKEQKIPIEITALINDTTGTLVASLYTDSETKMGVIFGTGVNGAY
YEDVADIPKLEGKLADDIPKDGPMAINCEYGSFDNEHLVLPRTKYDILVDEQSPRPGQQT
FEKMTSGYYLGELLRLVLVDLHSKGLILKNQDMTKLNQEYIMDTSYPAKIEEDPFENLED
TDALLKKDLGINTTVQERKLIRRLSELIATRSAHLSVCGIAAIFQKRGYKTGHVAADGSV
YKMYPGFVERAAEGLRKIYGWTPGPIDEYPIKICPSEDGSGAGGAIIAALAQKRIAAGKS
VGILGA

BLAST