GenomeNet

>ndi:NDAI_0C03810 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) NDAI0C03810; hypothetical protein (A)
MLSLRTRVATLPIKRTLLLQKSFFSTTRSCKLATTTTDTTTPFDNKDYHIIDHEYDCVVV
GAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNMHPDDWKWHMYDTV
KGSDWLGDQDSIHYMTREAPHSIIELEHYGMPFSRTEEGKIYQRAFGGQTKEYGKGEQAY
RTCAVADRTGHAMLHTLYGQALRHDTHFFIEFFAMDLLTHNGEVVGVIAYNQEDGTIHRF
RAHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLI
TEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITLEIREGRGVGNEKDHMFLQ
LNHLPPSVLKERLPGISETASIFAGVDVTKEPIPILPTVHYNMGGIPTKWNGEALTIDEE
TGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTVADTLQPNTPHKPVP
ADIGKESIANLDKIRNANGSRTTAEIRMNMKKTMQKDVSVFRTQESLDEGVSNITAVDKT
FDDVKISDRSLIWNSDLVETLELQNLLTCATQTAVSAAARKESRGAHAREDYPDRDDENW
MKHTLSWQSKAGAPVELKYRNVISTTLDEAECPSVPPTVRSY

BLAST