GenomeNet

>ndi:NDAI_0D00440 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (RefSeq) NDAI0D00440; hypothetical protein (A)
MLRMSRSIITRRSIHTIPKLNNITQLQTVGIPQILSAKGFNIIWTQTQDYLCKKLTMNTM
GTEMESNYPFHIVLKTSKDPMMSHVFNYASGVHNNHLFIENILPSATGKDNVPSKMFLNR
VKEYFDGKTWEELKELMIQEAMTRCLGQGWLFLVERANKRLDLMVLQNNGTPYYFGKNQQ
LDLNSAINLDEFNQLHDMKRRLKKGKGSPVVEGQEHDNNKDWTVPIICVNLWDHAYLNDY
GFLGKKDYIKNVLDNLNWAVINNRLYS

BLAST