GenomeNet

>ndi:NDAI_0D03850 K13524 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22] | (RefSeq) NDAI0D03850; hypothetical protein (A)
MTPAESYYPTEPSVPTVLTETVPGQFTLKAMSQLGEVFDVRPSYFVADFEKSIGNYIVDV
DGNTYLDLYAQIASIALGYNNPALIEVAKSPEMIRALVDRPALGNFPSKDLESMLKQILK
FAPKGQDHVWSGLSGADANELAFKAAFMYYKNKQRQGKDFTKEENESVMNNLPPGSPDLA
VLSFKRAFHGRLFASGSATCSKPIHKLDLPAFRWPHAEFPSYKYPLGDKANAEFNQREDD
RCLKNVEELIKTWPIPVAALLIEPIQSEGGDNHASKYFLQGLRDLTLKYNVVYIIDEVQT
GVGSTGKFWCHEYADITPPVDLVTFSKKFQSAGYFFHDPAFIPSAPYRQFNTWCGEPARM
LIAGAIGEEIVKNDLLSQCSRVGAYMFKKLEGLQKEHPTLFHNLRGKDRGTFIAWDLPSS
EQRDLLLKTLRANGCNVGGCSTNAVRLRPSLTFEEKHCDIFINVLAKSIAQVLV

BLAST