GenomeNet

>ndi:NDAI_0G05290 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) NDAI0G05290; hypothetical protein (A)
MTRDLQNHLLFETATEVANRVGGIYSVLKSKAPITVAQYKDNYCLIGPLNKATYQNEVDQ
LDWESPETFPDELKPIQTALHAMRSRGVNFIYAKWLIEGSPRVILFDLDSVKGFLNEWKG
DLWSLVGIPSPENDFETNDAILLGYTVAWFLGELTAVDKQHAIIAHFHEWLAGVALPLCR
KRMIDVVTIFTTHATLLGRYLCAAGDVDFYNNLEKFDVDQEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITAYEAEHLLKRKPDGILPNGLNVIKFQAVHEFQNLHALKKEKINEFVRGH
FHGCFDFDLDNTVYFFTAGRYEYKNKGADMFIEALARLNYRLKVAGSKLTVVAFIIMPAK
NNSFTVEALRGQAVVKSLENTVNEVTNSIGKRIFDHAMKFPNNGITSEIPVNLDELLKPS
DKVLLKKRVLGLRRAPGELPPIVTHNMVDDARDPILNQIRHVQLFNNSSDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETNQAKDYGIYIVDRRFKNPDESVEQLVDYMEEFCKKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLALRRAYPEQFKQLVGADLSDTNMDSLAGGKKLKIARPLSVPGSPRESR
SGSVSVAYMTPGDLGTLQDANNADDYFNLSLTGAHDDDDEQGPFVDDN

BLAST