GenomeNet

>ndi:NDAI_0I00590 NDAI0I00590; hypothetical protein; K00850 6-phosphofructokinase 1 [EC:2.7.1.11] (A)
MTVTTPLVNGTSYCLIKAYSQDSYKQAIEFYSKFLALDDCSTDNTTQTTTLSNGSISLKI
KLEEDKTLQSKTESQIQFLKSIKDTKDWRSHVAESLVFNTSNIMLNKDTLTTLNAPTQSF
PSDLFPMQLYTIDPLGNIIGVTSTKNAVSTMPTEPPSTKKAKFSTSTLPSKVHSFTDLSY
RMQTTNNYPSLPGKQIIDPTKPKKAIAVMTSGGDAQGMNSNVRAIVRSAIFKGCRAFVVM
EGYEGLVRGGPEYIKECSWEDVRGWSTEGGTNIGTARCLEFRQRDGRLLGAQHLIEAGVD
ALIVCGGDGSLTGADLFRSEWPSLIKELLENGRISKDQFQKYQHLNICGTVGSIDNDMST
TDATIGAYSALDRICKAIDYVEATANSHSRAFVVEVMGRNCGWLALLAGIATSADYIFIP
EKPATSSEWQDQMCDIVAKHRSKGKRTTIVIVAEGAISADLTPISPADVHKVLVDRLGLD
TRITTLGHVQRGGTAVAYDRMLATLQGVEAVNAVLESTADTPSPLIAINENKIVRKPLVE
SVRLTKSVAEAIQAKDFKKAMDLRDTEFVEHLKNFMAINSADHNEPKLPNDKRLKIAIVN
VGAPAGGINSAVYSMATYCMSQGHKPYAINNGWSGLARHESVRSLEWKDMIGWQSRGGSE
IGTNRVTPEQADIGMIAYYFQKYQFDGLVIVGGFEAFESLHQLERARESYPAFRIPMVLI
PATLSNNVPGTEYSLGSDTALNALMEYCDVVKQSASSTRGRAFVVDVQGGNSGYLATCAA
LAVGAQASYVPEEGIPLEQLQQDIETLAESFESAKGRGRFGKLILKSTNASKALSATDLA
KVMTSEANGRFDAKPAYPGHVQQGGLPSPIDRTRATRFAIRAVDFIEEQQETIAAARAAD
DDFKLDDKVVSATATVLGVRRSHIVFNPIRQLYDFETDVEARMPKVIHWQATREIADHLV
GRKRVD

BLAST