GenomeNet

>ndi:NDAI_0I03320 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) NDAI0I03320; hypothetical protein (A)
MVHLGPKKPPARKGSMADVPKELLEQLEELESVFHVSADQLKAVTKHFISELNKGLSKEG
GNIPMIPGWVVDYPTGKESGDYLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYKIPEGMRT
TQDPDELFGFIADSLKEFVEEIFPEGVSKPLPLGFTFSFPASQSKINSGVLQRWTKGFDI
PNVEGHDVVPMLQKQLEARKIPINVVALINDTTGTLVASLYTDADAKMGVIFGTGINGAY
YENVADIPKLEGKLADDIPKDSPMAINCEYGSFDNEHVVLPRNKYDIKIDEDSPRPGQQA
FEKMSSGYYLGELVRLALIDLHDKGFILKGQDMTKLNTPYIMDTSYPARIEEDPFENLED
TDALLQKDLGISTTVQERKLIRRLCELVGIRAARLAVCGIAAIFQKRGYKSGHAACDGSV
YKLYPGFQQHAAEALRDIFDWTPAPIDQYPIILSPSEDGSGAGAAIIAAVTEKRLAAGKS
VGVIGA

BLAST