GenomeNet

>ndi:NDAI_0J02790 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) NDAI0J02790; hypothetical protein (A)
MTTATVTTTNATAMTRSNSINNTDDSSFLWDDLKHWLTPKHSLPEAIQLFQNELQERLNT
STVSMIPTKSLSKGIRSSILDNVVAVNHKRILAIDFGGTRLKFAFVSMPDCKIQSQHDLE
ITNKIVNQDFFNDIIGWIVNHPSFLSNLDSIEDIDNDLLVAVTFSFPLNERKEIVAMGKG
FVMTDDLVGVPLDSILKKSFIENGMPNVKIGDIINDSVAVYLTSEVFCPQQIIGTKGENE
DVNSFSLILGTGTNSCFELPFDSLPVFKQWQFKDSLKKNENVKSSIINSEIGFLGTFIDL
APFDISTNRYSKINMPLETITSGKYIPIILQNILQDYHIISNLQSSAIKFDGQLVCELVK
QKNLTKLSLKYEEKFGLSLEQLIIVQKIAILLIQRAAFYLVGALKAIINLKYTKIVEENE
NQVFQFGYVGSFLQYCTFFQDQISIYSNNTIQLQFLEDSNLIGAAIAAFMN

BLAST