GenomeNet

>ndi:NDAI_0J02790 NDAI0J02790; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MTTATVTTTNATAMTRSNSINNTDDSSFLWDDLKHWLTPKHSLPEAIQLFQNELQERLNT
STVSMIPTKSLSKGIRSSILDNVVAVNHKRILAIDFGGTRLKFAFVSMPDCKIQSQHDLE
ITNKIVNQDFFNDIIGWIVNHPSFLSNLDSIEDIDNDLLVAVTFSFPLNERKEIVAMGKG
FVMTDDLVGVPLDSILKKSFIENGMPNVKIGDIINDSVAVYLTSEVFCPQQIIGTKGENE
DVNSFSLILGTGTNSCFELPFDSLPVFKQWQFKDSLKKNENVKSSIINSEIGFLGTFIDL
APFDISTNRYSKINMPLETITSGKYIPIILQNILQDYHIISNLQSSAIKFDGQLVCELVK
QKNLTKLSLKYEEKFGLSLEQLIIVQKIAILLIQRAAFYLVGALKAIINLKYTKIVEENE
NQVFQFGYVGSFLQYCTFFQDQISIYSNNTIQLQFLEDSNLIGAAIAAFMN

BLAST