GenomeNet

>ndi:NDAI_0K00690 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) NDAI0K00690; hypothetical protein (A)
MLHSHSTRQKGVSPPASDRGPSEVDIPQFQRGPRQSIVGLEDVKLLSSNLQQMSYHGATT
NTFDESNNKYIIPNHGLPEQTAYDLIHNELTLDGNPHLNLASFVNTTTTQIANRLIMENI
DKNLADNDEYPQLIELTQRCISMLAKLWKSNPDMEPIGCATTGSSEAIMLGGLAMKKIWE
AKMKKAGKSVEKPNILMSSACQVALEKFARYFEVECRLIPVCKESKYCLDPRKLWDYVDE
NTIGCYVLLGTTYTGHLENVEEVADVLTEIEIQHPSWSNKEIPIHVDGASGGFIVPFSFE
ASHMKKFGLERWGFNNPRVVSINTSGHKFGLTTPGLGWALWKDQSYLPPELRFRLKYLGG
VEETFNLNFSRPGFQVVHQYYNFVSLGFTGYKNHFLKSLFVARTFAYSLLKSEKLQDYIE
VISGIHERISDDKVPDNVTDYWENPQDFKPGVPLIAFKLSKHFNEAYPEIPQAIISKLLR
TRGWIVPNYPLPNSSDDSSNWEVLRVVFRTEMKLDFAQLLIIDIENIITKLLSCYEKVEE
HAEQEKQTKEGKRQFIYDMLLTLASPESEEDEKLKERVTRNYRGTC

BLAST