GenomeNet

>neu:NE0399 K02358 elongation factor Tu | (GenBank) tuf2; GTPases-translation elongation factors and sulfate adenylate transferase subunit 1 (A)
MAKSKFERVKPHVNVGTIGHVDHGKTTLTAAITTILTKKFGGEAKSYDQIDSAPEERARG
ITINTSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIIVFMNKADMVDDAELLELVEMEIRELLSNYDFPGDDTPIIIGSALKALE
GDKSDIGEAAILKLAEALDSYIPEPERAIDGAFIMPVEDVFSISGRGTVVTGRVERGIVK
VGDEIEIVGLKPTIKTVCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVERGQVLAKPGS
ILPHTKFTAEIYVLSKEEGGRHTPFFAGYRPQFYFRTTDVTGSIELPAGVEMVMPGDNIS
VTVNLIAPIAMDEGLRFAIREGGRTVGAGVVAKVIE

BLAST