GenomeNet

>neu:NE0399 tuf2; GTPases-translation elongation factors and sulfate adenylate transferase subunit 1 (EC:3.6.5.3); K02358 elongation factor Tu (A)
MAKSKFERVKPHVNVGTIGHVDHGKTTLTAAITTILTKKFGGEAKSYDQIDSAPEERARG
ITINTSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIIVFMNKADMVDDAELLELVEMEIRELLSNYDFPGDDTPIIIGSALKALE
GDKSDIGEAAILKLAEALDSYIPEPERAIDGAFIMPVEDVFSISGRGTVVTGRVERGIVK
VGDEIEIVGLKPTIKTVCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVERGQVLAKPGS
ILPHTKFTAEIYVLSKEEGGRHTPFFAGYRPQFYFRTTDVTGSIELPAGVEMVMPGDNIS
VTVNLIAPIAMDEGLRFAIREGGRTVGAGVVAKVIE

BLAST