GenomeNet

>nfi:NFIA_045480 animal haem peroxidase family protein; K17862 linoleate 10R-lipoxygenase [EC:1.13.11.62] (A)
MRPEPQTEGASSKPGNDSHAKFVDTGPKRIHEVQHFNELSREPPKGDVGAEQGGAIGRFK
DLSEVVHKATRPLPTETGNGTYIKDSSKGGSLWEDLLSLGIEDAKTVKDFVKTEALGRPM
DDKTMLMERIIQMVAKLPDKSKIREKGTHKFLGILWNSLPHPPLSYVGDKYAYRSADGSY
NNPTLPLLGAANTEYARTTEASKMRPASMPDPGLIFDSIFARETFKPHPNNVSSIFFTWA
SLIIHDVFQTGYPDQSINKTSSYLDLSTLYGDNQDEQNMMRTFEDGKIKPDCFSEPRLHM
LPAASGVILIMLNRFHNHVAEQLASINENGRFTKPKDEIIDPVEARAAWAKYDNDLFQTA
RLITCGMYINITLYDYLRTIINLNRDNSTWNLDPRTHDDQDEIPTAEGNQCSVEFNLAYR
WHSTIGRQDEAWTEKTYREIVGKPAQEATLQDLMEGMRKFNARMDKDPSKRTFAGLQRQG
DGTFKDVDLVDILTRAIEEVSGSFGPNNVPKVLRSVEILGIQQARKWNVGSLNEFRKFFD
LKPYESFEEINSDPYVADQLRHLYEHPDYVELYPGIVAEEPKEPMVPGVGIAPGYTVSRA
VLSDAVALVRGDRFYTKEFNARNLTNWGFSEANYNLEINQGCSFYRLALRAFPKWFKYDS
IYAHYPMTIPSENRVIMKALGREEDFSWDRPAYIPQRISVFDYANVRHILQDASNFRVMW
GEATAYVFGPKGWDFMLSGDAPTHANQRNIMSRALYRGQWHDAVKQFYLDITQQLLTEKS
CRVGNVNQVDISRDVGNLAHVHFASSVFSLPLKSREHPHGILTEHEMFEAMAVIFTAIFF
DAEPVKSFELRHKAREAAEKLGKLVEINVKAIKSSGLITTLLGNMHANKNALFEYGVHMV
ERLLQSGLDPEQVTWSQILPTAIAMVPNQAQVFTQIIDYYLSDNGRKHLPDIKRFAKEDS
PASDEVLLRYCMEAIRLNGIFGSYRKSQTNLTLDDKGGKVHIKAGDKVFVSFVDANRDPN
VFPKPKEVDLNRPMDSYIHYGVGPHTCLGGEASKVALTAMLRVVGRLDNLRRAPGAQGEL
KKISREHGFYTYMREDQSAFYPFPMSWKLHYDGEIPGKEQPVRGDFVCNVPGHWQN

BLAST